Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), FITC
Ataxin 1 단백질을 인식하는 FITC 결합 단일클론 항체로, Western blot, IHC, ICC/IF, IP에 사용 가능합니다. 인간, 마우스, 랫트에 반응하며 형광 검출이 용이합니다. 단백질 G로 정제된 액상 형태로 4°C 암소 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), FITC
Applications and Tested Dilutions
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:1,000 | |
| Immunohistochemistry (IHC) | Assay-dependent | |
| Immunocytochemistry (ICC/IF) | 1:100 | |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide amino acids 164–197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 |
| Conjugate | FITC |
| Excitation / Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 9.09 mM sodium bicarbonate/PBS, pH 7.4, with 640.91 mM DMSO, 136.36 mM ethanolamine |
| Contains | No preservative |
| Storage Conditions | 4°C, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932117 |
Additional Formats
- Unconjugated (MA5-27666)
- APC (MA5-45662)
- PE (MA5-45665)
- PerCP (MA5-45664)
- Custom conjugation available
Product Specific Information
- Rat: 100% identity (34/34 amino acids identical)
- Human: 88% identity (30/34 amino acids identical)
- 1 µg/mL of MA5-45663 detects Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot using Goat anti-mouse IgG:HRP as secondary antibody
- Detects approximately 85 kDa
- Formerly sold as clone S76-8
Target Information
The autosomal dominant cerebellar ataxias (ADCA) are a group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem, and spinal cord. ADCA types I–III have been identified, with SCA1 associated with CAG repeat expansion in the Ataxin-1 gene on chromosome 6. The disease allele contains 41–81 CAG repeats compared to 6–39 in normal alleles. The expanded repeats produce elongated polyglutamine tracts in the protein, leading to spinocerebellar ataxia type 1 (SCA1). The function of ataxins remains unclear. Two transcript variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.