Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PE
Ataxin 1 단백질을 검출하기 위한 PE-conjugated mouse monoclonal antibody. Western blot, IHC, ICC, IP에 사용 가능. Human, Mouse, Rat 반응성. 단백질 G로 정제된 액상 형태로 4°C 보관. 연구용으로만 사용.
- 카탈로그번호
- MA545665
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PE
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000 |
| Immunohistochemistry (IHC) | Assay-dependent |
| Immunocytochemistry (ICC/IF) | 1:100 |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide amino acids 164–197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 |
| Conjugate | PE (R-Phycoerythrin) |
| Excitation / Emission Max | 565 / 576 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932119 |
Additional Formats
Product Specific Information
- Rat: 100% identity (34/34 amino acids identical)
- Human: 88% identity (30/34 amino acids identical)
- 1 µg/mL of MA5-45665 detects Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 85 kDa.
- Formerly sold as clone S76-8.
Target Information
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem, and spinal cord. Clinically, ADCA is divided into three groups (types I–III).
ADCAI is genetically heterogeneous, with five genetic loci (SCA1, 2, 3, 4, and 6) on different chromosomes. ADCAII (SCA7) presents with retinal degeneration, and ADCAIII (SCA5) is a “pure” cerebellar syndrome.
These diseases are caused by CAG repeat expansions in the coding regions of SCA genes, resulting in elongated polyglutamine tracts. The expanded repeats are unstable and increase in size across generations.
The Ataxin 1 gene is mapped to chromosome 6 and associated with spinocerebellar ataxia type 1 (SCA1). Diseased alleles contain 41–81 CAG repeats compared to 6–39 in normal alleles. At least two transcript variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.