Thermo Fisher Scientific BMP5 Polyclonal Antibody
BMP5 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, Flow, ELISA 등 다양한 응용에 적합합니다. Human, Mouse, Rat 반응성을 가지며, 항원 친화 크로마토그래피로 정제되었습니다. 동결 건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific BMP5 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
| ELISA | 0.1–0.5 µg/mL | - |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human BMP-5 (332–365aa: HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745994 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TGF-ß family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. BMPs (Bone Morphogenetic Proteins) initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage.
BMP-5 is expressed in the nervous system, lungs, and liver, acting as a regulator of dendritic growth in sympathetic neurons. It is a 454 amino acid precursor protein cleaved to release the biologically active C-terminal mature protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.