Thermo Fisher Scientific BMP5 Polyclonal Antibody
BMP5 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, Flow, ELISA 등 다양한 응용에 적합합니다. Human, Mouse, Rat 반응성을 가지며, 항원 친화 크로마토그래피로 정제되었습니다. 동결 건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
| ELISA | 0.1–0.5 µg/mL | - |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human BMP-5 (332–365aa: HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745994 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TGF-ß family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. BMPs (Bone Morphogenetic Proteins) initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage.
BMP-5 is expressed in the nervous system, lungs, and liver, acting as a regulator of dendritic growth in sympathetic neurons. It is a 454 amino acid precursor protein cleaved to release the biologically active C-terminal mature protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific BMP6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP-2 Polyclonal Antibody
566,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|