Thermo Fisher Scientific BMP-2 Polyclonal Antibody
BMP-2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, WB, IHC, ELISA 등에 사용 가능. 인간 및 랫트 반응성, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도 유지. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| ELISA | 0.1–0.5 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283–312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745990 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Bone Morphogenic Proteins (BMPs) are members of the TGF-beta superfamily that affect bone and cartilage formation. Mature BMPs are 30–38 kDa proteins with a TGF-beta-like cysteine knot structure. Lovostatin increases bone formation by activating the bmp-2 gene. BMPs stimulate production of bone matrix proteins and influence stromal cell and osteoclast proliferation. They also play roles in development, cell proliferation, apoptosis, differentiation, and morphogenesis. BMPs are key in dorsal/ventral patterning and signal through Smad proteins via type I and II receptors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP-2 Polyclonal Antibody
566,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP5 Polyclonal Antibody, DyLight 488
661,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|