Thermo Fisher Scientific BMP-2 Polyclonal Antibody
BMP-2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, WB, IHC, ELISA 등에 사용 가능. 인간 및 랫트 반응성, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도 유지. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific BMP-2 Polyclonal Antibody
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| ELISA | 0.1–0.5 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283–312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745990 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Bone Morphogenic Proteins (BMPs) are members of the TGF-beta superfamily that affect bone and cartilage formation. Mature BMPs are 30–38 kDa proteins with a TGF-beta-like cysteine knot structure. Lovostatin increases bone formation by activating the bmp-2 gene. BMPs stimulate production of bone matrix proteins and influence stromal cell and osteoclast proliferation. They also play roles in development, cell proliferation, apoptosis, differentiation, and morphogenesis. BMPs are key in dorsal/ventral patterning and signal through Smad proteins via type I and II receptors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.