Thermo Fisher Scientific BMP4 Polyclonal Antibody
BMP4 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human 및 Mouse 시료에 반응합니다. Western Blot과 ELISA에 사용 가능하며, 고순도 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific BMP4 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293–324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745992 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family, part of the transforming growth factor-beta superfamily. BMPs are growth and differentiation factors originally identified by their ability to induce endochondral osteogenesis. BMP4 plays a crucial role in bone formation and development, and reduced expression is associated with bone disorders such as Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5′ untranslated region has been described, producing three variants encoding the same protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.