Thermo Fisher Scientific BMP4 Polyclonal Antibody
BMP4 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human 및 Mouse 시료에 반응합니다. Western Blot과 ELISA에 사용 가능하며, 고순도 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293–324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745992 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family, part of the transforming growth factor-beta superfamily. BMPs are growth and differentiation factors originally identified by their ability to induce endochondral osteogenesis. BMP4 plays a crucial role in bone formation and development, and reduced expression is associated with bone disorders such as Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5′ untranslated region has been described, producing three variants encoding the same protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific BMP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP-2 Polyclonal Antibody
566,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP5 Polyclonal Antibody, DyLight 488
661,800원
Thermo Fisher Scientific
Thermo Fisher Scientific BIK Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|