Thermo Fisher Scientific FAS Recombinant Rabbit Monoclonal Antibody (6C10Y3)
FAS 단백질을 표적으로 하는 Recombinant Rabbit Monoclonal Antibody (Clone 6C10Y3). Western blot, IHC, ELISA에 적합하며 Human 및 Rat 시료에 반응. 고순도의 Affinity Chromatography 정제, 안정적인 PBS/glycerol buffer 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:100–1:500 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | 6C10Y3 |
| Immunogen | Synthetic peptide corresponding to amino acids 50–150 of human Fas (NP_0000341) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2849210 |
Product Specific Information
Immunogen sequence:
EGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE
Target Information
FAS (Fas, CD95, APO-1)는 TNFR (tumor necrosis factor receptor) 수퍼패밀리에 속하는 46 kDa 막단백질로, 세포사멸 수용체로 작용합니다. 또한 약 26 kDa의 가용성 형태로도 존재합니다. FAS 자극은 FADD(FAS-associated death domain) 단백질의 응집과 death-inducing signaling complex (DISC) 형성, 그리고 caspase 활성화를 유도합니다. 복합체 내 caspase의 자가 절단은 하위 신호전달 경로를 활성화시켜 세포자멸(apoptosis)을 유도합니다. FAS는 NF-κB, MAPK3/ERK1, MAPK8/JNK를 활성화하며, 정상 섬유아세포 및 T세포의 증식 신호 전달에도 관여합니다. 최소 8개의 대체 스플라이싱 전사 변이체가 보고되었으며, 막관통 도메인이 없는 형태는 전체 길이 isoform이 매개하는 세포사멸을 억제할 수 있습니다. Fas/Fas ligand 시스템은 AIDS, 간염, 암 등 다양한 질환과 관련이 있으며, 항바이러스 면역반응에서 중요한 역할을 하는 것으로 알려져 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Glucocorticoid Receptor Recombinant Rabbit Monoclonal Antibody (ARC0062)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific ATG3 Recombinant Rabbit Monoclonal Antibody (ARC0073)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific FAS Recombinant Rabbit Monoclonal Antibody (6C10Y3)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD2 Recombinant Rabbit Monoclonal Antibody (ARC0055)
703,800원
Thermo Fisher Scientific
Thermo Fisher Scientific RIP1 Recombinant Rabbit Monoclonal Antibody (ARC0059)
598,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|