CacheBy
Thermo Fisher Scientific GRK2 Polyclonal Antibody
원본

Thermo Fisher Scientific GRK2 Polyclonal Antibody

상품 한눈에 보기

GRK2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용 가능. 고순도 항원 친화 크로마토그래피 정제, 동결건조 형태로 제공. 인간, 생쥐, 랫트 반응성.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 05:36
Thermo Fisher Scientific PA579330 GRK2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific GRK2 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Wet ice
RRID AB_2746446

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

ADRBK1 (GRK2) is a serine/threonine kinase involved in phosphorylation of G protein-coupled receptors (GPCRs). GRK2 (83 kDa) is ubiquitously expressed in mammals and regulates GPCR internalization through beta-arrestin-1, activating the Ras–Raf–ERK1&2 signaling pathway. GRK2 activity is controlled by phosphorylation (PKC, Src, ERK1&2) and protein interactions. ERK phosphorylates GRK2 at serine 670, inactivating it through negative feedback.

Usage Note

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.