
Thermo Fisher Scientific GRK2 Polyclonal Antibody
GRK2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용 가능. 고순도 항원 친화 크로마토그래피 정제, 동결건조 형태로 제공. 인간, 생쥐, 랫트 반응성.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GRK2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746446 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ADRBK1 (GRK2) is a serine/threonine kinase involved in phosphorylation of G protein-coupled receptors (GPCRs). GRK2 (83 kDa) is ubiquitously expressed in mammals and regulates GPCR internalization through beta-arrestin-1, activating the Ras–Raf–ERK1&2 signaling pathway. GRK2 activity is controlled by phosphorylation (PKC, Src, ERK1&2) and protein interactions. ERK phosphorylates GRK2 at serine 670, inactivating it through negative feedback.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
