Thermo Fisher Scientific GRK2 Polyclonal Antibody
GRK2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용 가능. 고순도 항원 친화 크로마토그래피 정제, 동결건조 형태로 제공. 인간, 생쥐, 랫트 반응성.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746446 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ADRBK1 (GRK2) is a serine/threonine kinase involved in phosphorylation of G protein-coupled receptors (GPCRs). GRK2 (83 kDa) is ubiquitously expressed in mammals and regulates GPCR internalization through beta-arrestin-1, activating the Ras–Raf–ERK1&2 signaling pathway. GRK2 activity is controlled by phosphorylation (PKC, Src, ERK1&2) and protein interactions. ERK phosphorylates GRK2 at serine 670, inactivating it through negative feedback.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GRK2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GRIK1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GRK5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|