
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
GSTA1~A5 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, WB 및 IHC(P) 검증 완료. 인체·마우스·랫트 반응성 보유. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 연구용 전용 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63–97 aa: MKLVQTRAILNYIASKYNLYGKDIKERALIDMYIE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746452 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress by conjugation with glutathione.
The genes encoding these enzymes are highly polymorphic, affecting susceptibility to carcinogens and toxins as well as drug efficacy and toxicity.
Eight distinct classes of soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta, and zeta.
This gene encodes a glutathione S-transferase belonging to the alpha class, located in a cluster on chromosome 6. Alpha class enzymes are abundantly expressed in liver and kidney and exhibit glutathione peroxidase activity, protecting cells from reactive oxygen species and peroxidation products.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific GSR Polyclonal Antibody
599,200원

Thermo Fisher Scientific
Thermo Fisher Scientific GSTM1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GRK2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|