Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody

Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody

상품 한눈에 보기

GSTA1~A5 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, WB 및 IHC(P) 검증 완료. 인체·마우스·랫트 반응성 보유. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 연구용 전용 제품.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 04. 오후 06:19
소모품
PA579336
Thermo Fisher Scientific PA579336 GSTA1/A2/A3/A4/A5 Polyclonal Antibody 100 ug pk
CAS: -단위: pk
재고문의재고: -
568,000
(VAT포함)624,800
소모품
PA579336
재고문의재고: -
Thermo Fisher Scientific PA579336 GSTA1/A2/A3/A4/A5 Polyclonal Antibody 100 ug pk
CAS: -단위: pk
568,000
(VAT포함)624,800

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 2–5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63–97 aa: MKLVQTRAILNYIASKYNLYGKDIKERALIDMYIE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746452

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress by conjugation with glutathione.
The genes encoding these enzymes are highly polymorphic, affecting susceptibility to carcinogens and toxins as well as drug efficacy and toxicity.
Eight distinct classes of soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta, and zeta.
This gene encodes a glutathione S-transferase belonging to the alpha class, located in a cluster on chromosome 6. Alpha class enzymes are abundantly expressed in liver and kidney and exhibit glutathione peroxidase activity, protecting cells from reactive oxygen species and peroxidation products.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0