Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
GSTA1~A5 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, WB 및 IHC(P) 검증 완료. 인체·마우스·랫트 반응성 보유. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 연구용 전용 제품.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63–97 aa: MKLVQTRAILNYIASKYNLYGKDIKERALIDMYIE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746452 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress by conjugation with glutathione.
The genes encoding these enzymes are highly polymorphic, affecting susceptibility to carcinogens and toxins as well as drug efficacy and toxicity.
Eight distinct classes of soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta, and zeta.
This gene encodes a glutathione S-transferase belonging to the alpha class, located in a cluster on chromosome 6. Alpha class enzymes are abundantly expressed in liver and kidney and exhibit glutathione peroxidase activity, protecting cells from reactive oxygen species and peroxidation products.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.