Thermo Fisher Scientific GRK5 Polyclonal Antibody
GRK5 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 적합. 인간, 생쥐, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 항체. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Mouse, Rat, Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393–429aa: KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746447 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
GRK5는 다양한 G 단백질 연결 수용체(GPCR)의 활성과 다형핵 백혈구의 운동성을 조절하는 세린/트레오닌 키나제입니다. 활성화된 GPCR 형태를 인산화하여 비활성화를 유도하며, 백혈구의 이동 조절에도 관여하는 것으로 알려져 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-79331_GRK5_P34947-1_Rabbit.svg)
(이미지: PA5-79331_GRK5_P34947-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GRK2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GRIK1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GRK5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GluR2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GluR3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|