Thermo Fisher Scientific GRK5 Polyclonal Antibody

상품 한눈에 보기

GRK5 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 적합. 인간, 생쥐, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 항체. 연구용으로만 사용 가능.

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2025. 08. 04. 오후 04:52

카탈로그 번호 · 상품 설명출고판매가담기

Thermo Fisher Scientific PA579331 GRK5 Polyclonal Antibody 100 ug pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

568,000원VAT 포함 624,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Application	Tested Dilution
Western Blot (WB)	0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))	0.5–1 µg/mL

Specification	Description
Species Reactivity	Mouse, Rat, Human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393–429aa: KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK)
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage Buffer	PBS with 5 mg BSA
Contains	0.05 mg sodium azide
Storage Conditions	−20°C
Shipping Conditions	Ambient (domestic); Wet ice (international)
RRID	AB_2746447

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

GRK5는 다양한 G 단백질 연결 수용체(GPCR)의 활성과 다형핵 백혈구의 운동성을 조절하는 세린/트레오닌 키나제입니다. 활성화된 GPCR 형태를 인산화하여 비활성화를 유도하며, 백혈구의 이동 조절에도 관여하는 것으로 알려져 있습니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

(이미지: PA5-79331_GRK5_P34947-1_Rabbit.svg)
(이미지: PA5-79331_GRK5_P34947-1_Rabbit_PDP.jpeg)

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.