Thermo Fisher Scientific ICAM-1 Polyclonal Antibody, Biotin, PeproTech

Thermo Fisher Scientific ICAM-1 Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human ICAM-1. Anti-Human ICAM-1-specific antibody was purified by affinity chromatography and then biotinylated.

Sandwich ELISA:
To detect Human ICAM-1 by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.25–1.0 µg/mL of this antibody is required. This biotinylated polyclonal antibody, in conjunction with PeproTech Polyclonal Anti-Human ICAM-1 (500-P287) as a capture antibody, allows detection of at least 0.2–0.4 ng/well of Recombinant Human ICAM-1.

Western Blot:
To detect Human ICAM-1 by Western Blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. Used with compatible secondary reagents, the detection limit for Recombinant Human ICAM-1 is 1.5–3.0 ng/lane under either reducing or non-reducing conditions.

Package Information:
500-P287BT-1MG will be provided as 2 × 500 µg.

Target Information

ICAM-1 (CD54) is an 85–110 kDa single-chain type 1 integral membrane glycoprotein with an extracellular domain of five immunoglobulin superfamily repeats, a transmembrane region, and a cytoplasmic domain.
ICAM-1 has 7 potential N-linked glycosylation sites and shares considerable amino acid sequence homology with ICAM-3 (CD50) and ICAM-2 (CD102).
ICAM-1 binds to integrins of type CD11a/CD18 (LFA-1) or CD11b/CD18 (Mac-1) and is exploited by Rhinovirus as a receptor.
It is expressed by activated endothelial cells and detected on epithelial cells, fibroblasts, chondrocytes, B lymphocytes, T lymphocytes (low), monocytes, macrophages, dendritic cells, and neutrophils, with levels increasing upon inflammation.
Soluble ICAM-1 is detectable in plasma and is elevated in patients with various inflammatory syndromes.

For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 파일명: 500-P287BT-25UG_ICAM-1_CD54_P05362-1_Rabbit.svg, 500-P287BT-25UG_ICAM-1_CD54_P05362-1_Rabbit_PDP.jpeg)