Thermo Fisher Scientific p16INK4a-TAT Polyclonal Antibody, Biotin, PeproTech

Applications

Western Blot (WB)

• Tested Dilution: 0.1–0.2 µg/mL

ELISA

• Tested Dilution: 0.25–1.0 µg/mL

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDGYGRKKRRQRRR

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human p16-INK4a-TAT.
Anti-Human p16-INK4a-TAT-specific antibody was purified by affinity chromatography and then biotinylated.

Sandwich ELISA:
To detect Human p16-INK4a-TAT by sandwich ELISA (100 µL/well), use 0.25–1.0 µg/mL of this antibody.
In conjunction with PeproTech Polyclonal Anti-Human p16-INK4a-TAT (500-P284) as a capture antibody, allows detection of at least 0.2–0.4 ng/well of Recombinant Human p16-INK4a-TAT.

Western Blot:
To detect Human p16-INK4a-TAT by Western Blot, use 0.1–0.2 µg/mL.
Detection limit: 1.5–3.0 ng/lane under reducing or non-reducing conditions.

Package:
500-P284TBT-1MG is provided as 2 × 500 µg.

Target Information

p16-INK4a is a nuclear protein regulating the cell cycle by inhibiting cyclin-dependent kinase-4 (CDK4) and CDK6.
It suppresses tumor formation and induces replicative senescence in normal cells, including stem cells.
Expression increases with age and accumulates in stem cell compartments.
Gene deletion or mutation is common in melanomas and other cancers.
TAT fusion proteins enable transduction of transcription factors and nuclear proteins into primary or transformed cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.