
Atlas Antibodies Anti-VPS9D1 Antibody
상품 한눈에 보기
Human VPS9D1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원으로 특이적으로 정제됨. 인간에 대한 반응성이 검증되었으며, 40% 글리세롤과 PBS 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VPS9D1 Antibody
Target Information
- Target Protein: VPS9 domain containing 1
- Target Gene: VPS9D1
- Alternative Gene Names: ATP-BL, C16orf7
Product Description
Polyclonal antibody against human VPS9D1.
Recommended Applications
이미지에 표시된 정보: IHC (Immunohistochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
EAYTEYLRSIHYISQVLLEEVETTKEAGETVPPDTSKMLKLAQQCLERAQSTAAKLGKTRLKPTMPAAAPIPQPAGRHRRVYSDEGGKLSPFLPPEIFQKLQGAESQSCKK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000001062 | 81% |
| Rat | ENSRNOG00000028904 | 79% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-VPS72 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS54 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS9D1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS53 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.