CacheBy
Atlas Antibodies Anti-VPS53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS53 Antibody

상품 한눈에 보기

Human VPS53 단백질을 인식하는 Rabbit polyclonal 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간 특이적 반응성을 검증하였으며, 보존성 높은 서열로 마우스 및 랫과도 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024446-100 Anti-VPS53 Antibody, vacuolar protein sorting 53 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024446-25 Anti-VPS53 Antibody, vacuolar protein sorting 53 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS53 Antibody

Anti-VPS53 Antibody

Target: vacuolar protein sorting 53 homolog (S. cerevisiae)

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human VPS53

Alternative Gene Names

FLJ10979, HCCS1

Open Datasheet (PDF)

Target Information

  • Target Protein: vacuolar protein sorting 53 homolog (S. cerevisiae)
  • Target Gene: VPS53

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000017288 95%
Rat ENSRNOG00000006895 94%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.