Atlas Antibodies Anti-VPS72 Antibody

상품 한눈에 보기

Human VPS72 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합합니다. VPS72의 Swc2, TCFL1, YL-1 등 대체 유전자명과 100% 일치하는 설치류 상동 단백질에 반응합니다. PrEST 항원을 이용해 친화 정제되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA065709-100 Anti-VPS72 Antibody, vacuolar protein sorting 72 homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA065709-25 Anti-VPS72 Antibody, vacuolar protein sorting 72 homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: vacuolar protein sorting 72 homolog (S. cerevisiae)
Supplier: Atlas Antibodies

Polyclonal antibody against human VPS72.

Swc2, TCFL1, YL-1, YL1

항목	내용
Target Protein	vacuolar protein sorting 72 homolog (S. cerevisiae)
Target Gene	VPS72
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand