
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VPS72 Antibody
상품 한눈에 보기
Human VPS72 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합합니다. VPS72의 Swc2, TCFL1, YL-1 등 대체 유전자명과 100% 일치하는 설치류 상동 단백질에 반응합니다. PrEST 항원을 이용해 친화 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA065709-100 Anti-VPS72 Antibody, vacuolar protein sorting 72 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065709-25 Anti-VPS72 Antibody, vacuolar protein sorting 72 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VPS72 Antibody
Anti-VPS72 Antibody
Target: vacuolar protein sorting 72 homolog (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human VPS72.
Alternative Gene Names
Swc2, TCFL1, YL-1, YL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | vacuolar protein sorting 72 homolog (S. cerevisiae) |
| Target Gene | VPS72 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000021081) – 100%
- Mouse (ENSMUSG00000008958) – 100%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



