CacheBy
Atlas Antibodies Anti-VPS54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS54 Antibody

상품 한눈에 보기

Human VPS54 단백질을 인식하는 Rabbit Polyclonal Antibody. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증되었으며, Rat 및 Mouse와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA070582-100 Anti-VPS54 Antibody, vacuolar protein sorting 54 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070582-25 Anti-VPS54 Antibody, vacuolar protein sorting 54 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS54 Antibody

Anti-VPS54 Antibody

Target: vacuolar protein sorting 54 homolog (S. cerevisiae)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VPS54.

Alternative Gene Names

HCC8, PPP1R164

Open Datasheet (PDF)

Target Information

  • Protein: vacuolar protein sorting 54 homolog (S. cerevisiae)
  • Gene: VPS54

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000007125 89%
Mouse ENSMUSG00000020128 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.