CacheBy
Atlas Antibodies Anti-VPS53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS53 Antibody

상품 한눈에 보기

Human VPS53 단백질을 대상으로 한 rabbit polyclonal IgG 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫드)을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.

카탈로그번호
HPA022988-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022988-100 Anti-VPS53 Antibody, vacuolar protein sorting 53 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022988-25 Anti-VPS53 Antibody, vacuolar protein sorting 53 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS53 Antibody

Anti-VPS53 Antibody

Target: vacuolar protein sorting 53 homolog (S. cerevisiae)

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human VPS53

Alternative Gene Names

FLJ10979, HCCS1

Open Datasheet

Target Information

  • Target Protein: vacuolar protein sorting 53 homolog (S. cerevisiae)
  • Target Gene: VPS53

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000017288 (95%)
  • Rat ENSRNOG00000006895 (94%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.