Thermo Fisher Scientific Pokemon Polyclonal Antibody
Rabbit polyclonal antibody recognizing human ZBTB7A (Pokemon) protein. Validated for WB, IHC, ICC/IF, and Flow Cytometry. Lyophilized form, reconstitutable to 500 µg/mL. Suitable for research use only.
- 카탈로그번호
- PA580247
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Pokemon Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg / 1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125–163 aa: DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747361 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ZBTB7A (Pokemon) plays a key role in directing early lymphoid progenitors to develop into the B-cell lineage by repressing T-cell instructive Notch signals. It specifically represses transcription of the CDKN2A gene and efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5′-[GA][CA]GACCCCCCCCC-3′.
Additional Information
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.