
Thermo Fisher Scientific Pokemon Polyclonal Antibody
Thermo Fisher Scientific의 Pokemon Polyclonal Antibody는 마우스와 랫트에서 반응하는 rabbit IgG 기반의 다클론 항체입니다. Western blot 및 IHC(P) 적용에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. PBS/BSA 버퍼에 보관하며 -20°C에서 안정적으로 저장됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Pokemon Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse ZBTB7A (125–163aa DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747360 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5’-[GA][CA]GACCCCCCCCC-3’.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-80246_Pokemon_O88939-1_Rabbit.svg, PA5-80246_Pokemon_O88939-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
