Thermo Fisher Scientific ZP2 Polyclonal Antibody
인간 ZP2 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot 및 Immunohistochemistry에 적합. 항원 친화 크로마토그래피로 정제되었으며, Lyophilized 형태로 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ZP2 Polyclonal Antibody
Thermo Fisher Scientific ZP2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511–544aa: ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747362 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It consists mainly of three or four glycoproteins that play essential roles during fertilization and preimplantation development. The ZP2 protein is a structural component of the zona pellucida, mediating secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein includes an N-terminal signal peptide, a conserved ZP domain, a furin cleavage site, and a C-terminal transmembrane domain. Furin cleavage may release the mature protein for incorporation into the zona pellucida matrix, although its necessity remains debated in mouse models.
Usage Notice
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.