Thermo Fisher Scientific ZP2 Polyclonal Antibody
인간 ZP2 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot 및 Immunohistochemistry에 적합. 항원 친화 크로마토그래피로 정제되었으며, Lyophilized 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific ZP2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511–544aa: ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747362 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It consists mainly of three or four glycoproteins that play essential roles during fertilization and preimplantation development. The ZP2 protein is a structural component of the zona pellucida, mediating secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein includes an N-terminal signal peptide, a conserved ZP domain, a furin cleavage site, and a C-terminal transmembrane domain. Furin cleavage may release the mature protein for incorporation into the zona pellucida matrix, although its necessity remains debated in mouse models.
Usage Notice
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific BirA Polyclonal Antibody
284,500원
Thermo Fisher Scientific
Thermo Fisher Scientific BirA Polyclonal Antibody
424,300원
Thermo Fisher Scientific
Thermo Fisher Scientific ZP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Pokemon Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Pokemon Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|