Thermo Fisher Scientific TECK Polyclonal Antibody, PeproTech

Applications

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHA VKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human TECK (CCL25). Anti-Human TECK (CCL25)-specific antibody was purified by affinity chromatography employing an immobilized Human TECK (CCL25) matrix.

Sandwich ELISA:
To detect Human TECK (CCL25) by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.5–2.0 µg/mL of this antibody is required. In conjunction with PeproTech Biotinylated Anti-Human TECK (CCL25) (500-P134Bt) as a detection antibody, allows detection of at least 0.2–0.4 ng/well of Recombinant Human TECK (CCL25).

Western Blot:
To detect Human TECK (CCL25) by Western Blot, use at a concentration of 0.1–0.2 µg/mL. Detection limit for Recombinant Human TECK (CCL25) is 1.5–3.0 ng/lane under reducing or non-reducing conditions.

Target Information

Chemokines regulate the trafficking of developing T cells within the thymus. Chemokine C-C thymus expressed chemokine (TECK), also known as chemokine ligand 25 (CCL25), is expressed predominantly in thymic dendritic cells, thymic epithelial cells, and the small intestine. TECK, a CCR9 ligand, suppresses immature subsets of myeloid progenitors stimulated by multiple growth factors. It delivers signals through CCR9, essential for thymocyte navigation. Bone marrow pre-pro-B cells and progenitors responsive to interleukin-7 and Flt-3 ligand migrate to TECK, a response lost in later B cell stages.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지