Thermo Fisher Scientific TECK Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHA V KKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human TECK (CCL25). Anti-Human TECK (CCL25)-specific antibody was purified by affinity chromatography and then biotinylated.

Sandwich ELISA:
To detect Human TECK (CCL25) by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.25–1.0 µg/mL of this antibody is required. This biotinylated polyclonal antibody, in conjunction with PeproTech Polyclonal Anti-Human TECK (CCL25) (500-P134) as a capture antibody, allows the detection of at least 0.2–0.4 ng/well of Recombinant Human TECK (CCL25).

Western Blot:
To detect hTECK by Western Blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. Used with compatible secondary reagents, the detection limit for Recombinant hTECK is 1.5–3.0 ng/lane, under either reducing or non-reducing conditions.

Packaging:
500-P134BT-1MG will be provided as 2 × 500 µg.

Target Information

Chemokines are likely to play an important role in regulating the trafficking of developing T cells within the thymus. Chemokine C-C thymus expressed chemokine (TECK), also designated chemokine ligand 25 (CCL25), small inducible cytokine A25, chemokine b-15 or CK b-15, is expressed predominantly in thymic dendritic cells, thymic epithelial cells and in the small intestine. TECK, a CCR9 ligand, has suppressive activity against immature subsets of myeloid progenitors stimulated by multiple growth factors. TECK delivers signals through CCR9, which is important for the navigation of developing thymocytes. Bone marrow pre-pro-B cells and cells capable of generating pro-B colonies in the presence of interleukin-7 and Flt-3 ligand migrate to TECK, a response lost in later stages of B cell development.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.