Thermo Fisher Scientific PSMA4 Polyclonal Antibody
PSMA4 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot 검증 완료. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 제품으로, 재구성 시 500 µg/mL 농도. 연구용 전용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84–123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747006 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of four rings of 28 non-identical subunits; two rings consist of seven alpha subunits and two rings consist of seven beta subunits. Proteasomes are distributed throughout eukaryotic cells and cleave peptides in an ATP/ubiquitin-dependent, non-lysosomal pathway. The immunoproteasome plays an essential role in processing class I MHC peptides.
This gene encodes a member of the peptidase T1A family, a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PSMA3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PTPN22 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PSMA4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PTP1B Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PTP4A2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|