Thermo Fisher Scientific PSMA4 Polyclonal Antibody
PSMA4 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot 검증 완료. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 제품으로, 재구성 시 500 µg/mL 농도. 연구용 전용.
- 카탈로그번호
- PA579891
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PSMA4 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84–123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747006 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of four rings of 28 non-identical subunits; two rings consist of seven alpha subunits and two rings consist of seven beta subunits. Proteasomes are distributed throughout eukaryotic cells and cleave peptides in an ATP/ubiquitin-dependent, non-lysosomal pathway. The immunoproteasome plays an essential role in processing class I MHC peptides.
This gene encodes a member of the peptidase T1A family, a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.