
원본
Thermo Fisher Scientific PTP4A2 Polyclonal Antibody
상품 한눈에 보기
PTP4A2 단백질 인식용 Rabbit Polyclonal 항체로 Western blot, IHC, Flow Cytometry에 적합. 인간 및 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 04:47
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579893 PTP4A2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific PTP4A2 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40–69 aa: TTLVRVCDATYDKAPVEKEGIHVLDWPFDD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747008 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PRL-2 (Protein tyrosine phosphatase 4a2, PTP4A2)는 핵 내 단백질 타이로신 포스파타아제로, 다양한 세포 과정 조절에 중심적인 역할을 수행합니다.
PRL-1은 자극된 세포 및 재생 간에서 유도되며, PRL-2는 PRL-1과 87%의 아미노산 서열 상동성을 가집니다.
모든 마우스 PRL 단백질은 프레닐화(prenylation)를 위한 C-말단 공통 서열을 가지며, Cdc14p 및 종양 억제 단백질 PTEN/MMAC1과 상당한 서열 상동성을 보입니다.
PRL-2는 주로 골격근에서 발현되며, 다른 조직에서는 낮은 수준으로 발현됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
