CacheBy
Thermo Fisher Scientific PTP4A2 Polyclonal Antibody
원본

Thermo Fisher Scientific PTP4A2 Polyclonal Antibody

상품 한눈에 보기

PTP4A2 단백질 인식용 Rabbit Polyclonal 항체로 Western blot, IHC, Flow Cytometry에 적합. 인간 및 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 04:47
Thermo Fisher Scientific PA579893 PTP4A2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific PTP4A2 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40–69 aa: TTLVRVCDATYDKAPVEKEGIHVLDWPFDD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747008

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

PRL-2 (Protein tyrosine phosphatase 4a2, PTP4A2)는 핵 내 단백질 타이로신 포스파타아제로, 다양한 세포 과정 조절에 중심적인 역할을 수행합니다.
PRL-1은 자극된 세포 및 재생 간에서 유도되며, PRL-2는 PRL-1과 87%의 아미노산 서열 상동성을 가집니다.
모든 마우스 PRL 단백질은 프레닐화(prenylation)를 위한 C-말단 공통 서열을 가지며, Cdc14p 및 종양 억제 단백질 PTEN/MMAC1과 상당한 서열 상동성을 보입니다.
PRL-2는 주로 골격근에서 발현되며, 다른 조직에서는 낮은 수준으로 발현됩니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.