Thermo Fisher Scientific PSMA3 Polyclonal Antibody
PSMA3 단백질을 검출하기 위한 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합. Human, Mouse, Rat 반응성. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도. 항원 친화 크로마토그래피로 정제됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human PSMA3 (88–127 aa: LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747005 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core consists of four rings of 28 non-identical subunits: two rings of seven alpha subunits and two rings of seven beta subunits. Proteasomes are abundant in eukaryotic cells and cleave peptides in an ATP/ubiquitin-dependent, non-lysosomal pathway. The immunoproteasome variant processes class I MHC peptides. The PSMA3 gene encodes a 20S core alpha subunit of the peptidase T1A family, with two known isoforms from alternative transcripts.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Paxillin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PTPRF Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PSMA3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PTPN22 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PSMA4 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|