Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PerCP
Ataxin 1 단백질을 검출하기 위한 PerCP 결합 단클론 항체로, Western blot, IHC, ICC/IF, IP 등에 사용 가능. 인간, 생쥐, 랫드 반응성. 단일 클론 N76/8, Protein G 정제, 4°C 보관. 연구용 전용 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:1,000 | |
| Immunohistochemistry (IHC) | Assay-dependent | |
| Immunocytochemistry (ICC/IF) | 1:100 | |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide (aa 164–197: ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 |
| Conjugate | PerCP |
| Excitation / Emission Max | 482 / 675 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932118 |
Additional Formats Available:
Product Specific Information
- Rat: 100% identity (34/34 amino acids identical)
- Human: 88% identity (30/34 amino acids identical)
- 1 µg/mL of MA5-45664 detects Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot using Goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 85 kDa protein.
- Formerly sold as clone S76-8.
Target Information
Autosomal dominant cerebellar ataxias (ADCA) are heterogeneous neurodegenerative disorders involving progressive degeneration of the cerebellum, brain stem, and spinal cord.
ADCA is divided into three groups (types I–III).
Type I includes spinocerebellar ataxia (SCA) 1, 2, 3, 4, and 6.
Type II (SCA7) presents with retinal degeneration, and Type III (SCA5) is a pure cerebellar syndrome.
These diseases result from CAG repeat expansions in coding regions, leading to elongated polyglutamine tracts.
The Ataxin 1 gene, mapped to chromosome 6, is associated with spinocerebellar ataxia type 1 (SCA1).
Disease alleles contain 41–81 CAG repeats compared to 6–39 in normal alleles.
At least two transcript variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), PE
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), FITC
663,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|