Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PerCP
Ataxin 1 단백질을 검출하기 위한 PerCP 결합 단클론 항체로, Western blot, IHC, ICC/IF, IP 등에 사용 가능. 인간, 생쥐, 랫드 반응성. 단일 클론 N76/8, Protein G 정제, 4°C 보관. 연구용 전용 제품.
- 카탈로그번호
- MA545664
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PerCP
Applications and Tested Dilutions
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:1,000 | |
| Immunohistochemistry (IHC) | Assay-dependent | |
| Immunocytochemistry (ICC/IF) | 1:100 | |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide (aa 164–197: ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 |
| Conjugate | PerCP |
| Excitation / Emission Max | 482 / 675 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932118 |
Additional Formats Available:
Product Specific Information
- Rat: 100% identity (34/34 amino acids identical)
- Human: 88% identity (30/34 amino acids identical)
- 1 µg/mL of MA5-45664 detects Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot using Goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 85 kDa protein.
- Formerly sold as clone S76-8.
Target Information
Autosomal dominant cerebellar ataxias (ADCA) are heterogeneous neurodegenerative disorders involving progressive degeneration of the cerebellum, brain stem, and spinal cord.
ADCA is divided into three groups (types I–III).
Type I includes spinocerebellar ataxia (SCA) 1, 2, 3, 4, and 6.
Type II (SCA7) presents with retinal degeneration, and Type III (SCA5) is a pure cerebellar syndrome.
These diseases result from CAG repeat expansions in coding regions, leading to elongated polyglutamine tracts.
The Ataxin 1 gene, mapped to chromosome 6, is associated with spinocerebellar ataxia type 1 (SCA1).
Disease alleles contain 41–81 CAG repeats compared to 6–39 in normal alleles.
At least two transcript variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.