Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
Ataxin 1 단백질 검출용 Thermo Fisher Scientific의 APC 결합 단클론 항체로, Human, Mouse, Rat에 반응합니다. Western blot, IHC, ICC, IP에 사용 가능하며, 1 mg/mL 농도의 액상 형태로 제공됩니다. Protein G 정제, 보존제 무첨가, 연구용 전용 제품입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
Applications 및 권장 희석 배수
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000 |
| Immunohistochemistry (IHC) | Assay-dependent |
| Immunocytochemistry (ICC/IF) | 1:100 |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide amino acids 164–197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 |
| Conjugate | APC |
| Excitation / Emission Max | 651 / 660 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932116 |
추가 포맷 제공
- Unconjugated (MA5-27666)
- FITC (MA5-45663)
- PE (MA5-45665)
- PerCP (MA5-45664)
- Custom conjugation 요청 가능
Product Specific Information
- Rat: 100% identity (34/34 amino acids identical)
- Human: 88% identity (30/34 amino acids identical)
- 1 µg/mL의 MA5-45662는 20 µg rat brain lysate에서 Ataxin-1 검출에 충분하며, Goat anti-mouse IgG:HRP를 2차 항체로 사용한 colorimetric immunoblot 분석에서 약 85 kDa 단백질을 검출함
- 본 항체는 이전에 clone S76-8로 판매되었음
Target Information
Autosomal dominant cerebellar ataxias (ADCA)는 소뇌, 뇌간 및 척수의 진행성 퇴행을 특징으로 하는 신경퇴행성 질환군입니다. ADCA는 임상적으로 I–III형으로 분류되며, SCA1, 2, 3, 4, 6 등의 유전적 위치와 관련되어 있습니다.
ADCA는 CAG 반복 확장에 의해 발생하며, 이는 단백질 내 polyglutamine tract을 연장시켜 질환을 유발합니다. SCA1 관련 유전자는 염색체 6에 위치하며, 질병 대립유전자는 41–81개의 CAG 반복을 포함합니다.
적어도 두 개의 전사체 변이가 동일한 단백질을 암호화하는 것으로 알려져 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), FITC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PE
663,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|