원본
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
상품 한눈에 보기
Ataxin 1 단백질 검출용 Thermo Fisher Scientific의 APC 결합 단클론 항체로, Human, Mouse, Rat에 반응합니다. Western blot, IHC, ICC, IP에 사용 가능하며, 1 mg/mL 농도의 액상 형태로 제공됩니다. Protein G 정제, 보존제 무첨가, 연구용 전용 제품입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 09:27
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA545662 Ataxin 1 Monoclonal Antibody (N76/8), APC 100 ug pk판매 단위 pk ·
재고 확인 필요
663,800원VAT 포함 730,180원
Thermo Fisher Scientific · Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), APC
Applications 및 권장 희석 배수
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000 |
| Immunohistochemistry (IHC) | Assay-dependent |
| Immunocytochemistry (ICC/IF) | 1:100 |
| Immunoprecipitation (IP) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide amino acids 164–197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 |
| Conjugate | APC |
| Excitation / Emission Max | 651 / 660 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932116 |
추가 포맷 제공
- Unconjugated (MA5-27666)
- FITC (MA5-45663)
- PE (MA5-45665)
- PerCP (MA5-45664)
- Custom conjugation 요청 가능
Product Specific Information
- Rat: 100% identity (34/34 amino acids identical)
- Human: 88% identity (30/34 amino acids identical)
- 1 µg/mL의 MA5-45662는 20 µg rat brain lysate에서 Ataxin-1 검출에 충분하며, Goat anti-mouse IgG:HRP를 2차 항체로 사용한 colorimetric immunoblot 분석에서 약 85 kDa 단백질을 검출함
- 본 항체는 이전에 clone S76-8로 판매되었음
Target Information
Autosomal dominant cerebellar ataxias (ADCA)는 소뇌, 뇌간 및 척수의 진행성 퇴행을 특징으로 하는 신경퇴행성 질환군입니다. ADCA는 임상적으로 I–III형으로 분류되며, SCA1, 2, 3, 4, 6 등의 유전적 위치와 관련되어 있습니다.
ADCA는 CAG 반복 확장에 의해 발생하며, 이는 단백질 내 polyglutamine tract을 연장시켜 질환을 유발합니다. SCA1 관련 유전자는 염색체 6에 위치하며, 질병 대립유전자는 41–81개의 CAG 반복을 포함합니다.
적어도 두 개의 전사체 변이가 동일한 단백질을 암호화하는 것으로 알려져 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), PerCP663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PerCP663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Protocadherin Gamma Monoclonal Antibody (N159/5), FITC663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8), PE663,800원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.