Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP
SUR2A 단백질을 검출하기 위한 PerCP 결합 단일클론 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot, IHC, ICC/IF에 사용 가능하며, 120 kDa 밴드 검출에 특이적입니다. Protein G 정제, 1 mg/mL 농도, 보존제 없음.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP
Applications and Tested Dilution
- Western Blot (WB): 1:1,000
- Immunohistochemistry (IHC): Assay-dependent
- Immunocytochemistry (ICC/IF): Assay-dependent
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | PerCP |
| Excitation/Emission Max | 482/675 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage conditions | 4°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932063 |
Additional Formats
Product Specific Information
- 1 µg/mL of MA5-45609 detects SUR2A in 20 µg of mouse brain membrane lysate by colorimetric immunoblot using goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 120 kDa.
- Does not cross-react with SUR2B.
- Formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins that serve as molecular targets for sulfonylurea class anti-diabetic drugs, promoting insulin release from pancreatic beta cells. SUR proteins function as subunits of inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The KATP channel, composed of four Kir6.x and four SUR subunits, regulates cellular energy balance by responding to intracellular ATP and ADP levels to control channel opening and closing.
Usage Notice
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PE
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), APC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NOTCH1 Monoclonal Antibody (N253/32), FITC
663,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327/95), FITC
663,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|