원본
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP
상품 한눈에 보기
SUR2A 단백질을 검출하기 위한 PerCP 결합 단일클론 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot, IHC, ICC/IF에 사용 가능하며, 120 kDa 밴드 검출에 특이적입니다. Protein G 정제, 1 mg/mL 농도, 보존제 없음.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 28. 오후 01:53
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA545609 SUR2A Monoclonal Antibody (N319A/14), PerCP 100 ug pk판매 단위 pk ·
재고 확인 필요
663,800원VAT 포함 730,180원
Thermo Fisher Scientific · Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP
Applications and Tested Dilution
- Western Blot (WB): 1:1,000
- Immunohistochemistry (IHC): Assay-dependent
- Immunocytochemistry (ICC/IF): Assay-dependent
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | PerCP |
| Excitation/Emission Max | 482/675 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage conditions | 4°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932063 |
Additional Formats
Product Specific Information
- 1 µg/mL of MA5-45609 detects SUR2A in 20 µg of mouse brain membrane lysate by colorimetric immunoblot using goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 120 kDa.
- Does not cross-react with SUR2B.
- Formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins that serve as molecular targets for sulfonylurea class anti-diabetic drugs, promoting insulin release from pancreatic beta cells. SUR proteins function as subunits of inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The KATP channel, composed of four Kir6.x and four SUR subunits, regulates cellular energy balance by responding to intracellular ATP and ADP levels to control channel opening and closing.
Usage Notice
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PE663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), APC663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NOTCH1 Monoclonal Antibody (N253/32), FITC663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327/95), FITC663,800원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.