원본
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), APC
상품 한눈에 보기
SUR2A 단백질을 인식하는 APC 결합 단클론 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot, IHC, ICC에 사용 가능하며, 120kDa SUR2A 검출에 특이적입니다. Protein G 정제, 액상 형태로 보존하며, 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:19
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA545607 SUR2A Monoclonal Antibody (N319A/14), APC 100 ug pk판매 단위 pk ·
재고 확인 필요
663,800원VAT 포함 730,180원
Thermo Fisher Scientific · Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), APC
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), APC
Applications and Tested Dilution
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:1,000 | |
| Immunohistochemistry (IHC) | Assay-dependent | |
| Immunocytochemistry (ICC/IF) | Assay-dependent |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | APC |
| Excitation / Emission Max | 651 / 660 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932061 |
Additional Formats
- Unconjugated (MA5-27637)
- FITC (MA5-45608)
- PE (MA5-45610)
- PerCP (MA5-45609)
- Custom conjugation available upon request
Product Specific Information
- 1 µg/mL of MA5-45607 detects SUR2A in 20 µg of mouse brain membrane lysate using colorimetric immunoblot with goat anti-mouse IgG:HRP secondary antibody.
- Detects approximately 120 kDa.
- Does not cross-react with SUR2B.
- Formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins that serve as molecular targets of sulfonylurea anti-diabetic drugs, which promote insulin release from pancreatic beta cells. SUR proteins are subunits of inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). Four Kir6.x and four SUR subunits form the KATP channel, which monitors cellular energy balance by sensing ATP and ADP levels and regulating channel opening and closing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327/95), PerCP663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PE663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NOTCH1 Monoclonal Antibody (N253/32), FITC663,800원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.