원본
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PE
상품 한눈에 보기
SUR2A 단백질을 특이적으로 인식하는 Thermo Fisher Scientific의 단클론 항체. PE로 결합되어 형광 분석에 적합하며, WB, IHC, ICC/IF 등 다양한 응용에 사용 가능. 사람, 마우스, 랫트 반응성. 단백질 G 정제, 보존제 없음, 4°C 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 07:19
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA545610 SUR2A Monoclonal Antibody (N319A/14), PE 100 ug pk판매 단위 pk ·
재고 확인 필요
663,800원VAT 포함 730,180원
Thermo Fisher Scientific · Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PE
Applications and Tested Dilution
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:1,000 | — |
| Immunohistochemistry (IHC) | Assay-dependent | — |
| Immunocytochemistry (ICC/IF) | Assay-dependent | — |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | PE (R-Phycoerythrin) |
| Excitation / Emission Max | 565 / 576 nm |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | 95.64 mM phosphate / 2.48 mM MES, pH 7.4, with 0.5 M EDTA |
| Contains | No preservative |
| Storage Conditions | 4°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2932064 |
Available Formats
- Unconjugated (MA5-27637)
- APC (MA5-45607)
- FITC (MA5-45608)
- PerCP (MA5-45609)
- Request custom conjugation
Product Specific Information
- 1 µg/mL of MA5-45610 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
- Detects approximately 120 kDa.
- Does not cross-react with SUR2B.
- This antibody was formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins targeted by sulfonylurea class anti-diabetic drugs that promote insulin release from pancreatic beta cells. SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). Four Kir6.x and four SUR subunits form the KATP channel, which regulates cellular energy balance by sensing intracellular ATP and ADP levels and controlling potassium ion flow accordingly.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327/95), PE663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific NMDAR2A Monoclonal Antibody (N327/95), PerCP663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), APC663,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14), PerCP663,800원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.