Thermo Fisher Scientific BMP5 Polyclonal Antibody, DyLight 488
BMP5 단백질을 인식하는 DyLight 488 결합 토끼 폴리클로날 항체로, 유세포분석(Flow Cytometry)에 적합합니다. 인체 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 4°C에서 암소 보관하며 동결 금지.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Flow Cytometry (Flow): 1–3 µg/1×10⁶ cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332–365aa: HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) |
| Conjugate | DyLight™ 488 |
| Excitation / Emission Max | 492 / 519 nm |
| Form | Liquid |
| Concentration | 200 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | 4°C, store in dark, DO NOT FREEZE |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745993 |
Target Information
TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage.
BMP-5 is expressed in the nervous system, lungs, and liver, and regulates dendritic growth in sympathetic neurons. It is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific BMP-2 Polyclonal Antibody
566,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP5 Polyclonal Antibody, DyLight 488
661,800원
Thermo Fisher Scientific
Thermo Fisher Scientific BIK Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Osteocalcin Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|