원본
Thermo Fisher Scientific BMP5 Polyclonal Antibody, DyLight 488
상품 한눈에 보기
BMP5 단백질을 인식하는 DyLight 488 결합 토끼 폴리클로날 항체로, 유세포분석(Flow Cytometry)에 적합합니다. 인체 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 4°C에서 암소 보관하며 동결 금지.
- 카탈로그번호
- PA578877
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 01:44
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578877 BMP5 Polyclonal Antibody, DyLight 488 100 ug pk판매 단위 pk ·
재고 확인 필요
661,800원VAT 포함 727,980원
Thermo Fisher Scientific · Thermo Fisher Scientific BMP5 Polyclonal Antibody, DyLight 488
Applications
- Flow Cytometry (Flow): 1–3 µg/1×10⁶ cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332–365aa: HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) |
| Conjugate | DyLight™ 488 |
| Excitation / Emission Max | 492 / 519 nm |
| Form | Liquid |
| Concentration | 200 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | 4°C, store in dark, DO NOT FREEZE |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745993 |
Target Information
TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage.
BMP-5 is expressed in the nervous system, lungs, and liver, and regulates dendritic growth in sympathetic neurons. It is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific BMP-2 Polyclonal Antibody566,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific BMP4 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific BIK Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Osteocalcin Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.