
Atlas Antibodies Anti-TFF1 Antibody
상품 한눈에 보기
Human TFF1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합. RNA-seq 데이터 기반의 Orthogonal Validation 수행. Rabbit 호스트, IgG 아이소타입, PrEST 항원으로 친화 정제. 인간 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TFF1 Antibody
Target Information
- Target Protein: Trefoil factor 1
- Target Gene: TFF1
- Alternative Gene Names: BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Product Description
Polyclonal Antibody against Human TFF1
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE - Verified Species Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000001164 (66%)
- Mouse ENSMUSG00000024032 (64%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
