Atlas Antibodies Anti-TFF2 Antibody

상품 한눈에 보기

Human TFF2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal Validation 수행. Affinity purification 방식으로 정제되었으며, 40% glycerol 기반 buffer에 보존. Human에 대해 검증됨.

카탈로그번호: HPA036705-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036705-100 Anti-TFF2 Antibody, trefoil factor 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036705-25 Anti-TFF2 Antibody, trefoil factor 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TFF2 Antibody

Anti-TFF2 Antibody

Target: Trefoil factor 2 (TFF2)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human TFF2.

Alternative Gene Names

SML1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Trefoil factor 2
Target Gene	TFF2
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	PHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWC