CacheBy
Atlas Antibodies Anti-TFB2M Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TFB2M Antibody

상품 한눈에 보기

Human TFB2M 단백질을 인식하는 폴리클로날 항체로, Western Blot과 Immunocytochemistry에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030265-100 Anti-TFB2M Antibody, transcription factor B2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030265-25 Anti-TFB2M Antibody, transcription factor B2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFB2M Antibody

Anti-TFB2M Antibody

Target: Transcription factor B2, mitochondrial
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TFB2M.


Alternative Gene Names

FLJ22661, FLJ23182, Hkp1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transcription factor B2, mitochondrial
Target Gene TFB2M
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETL
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000002695 (36%), Mouse ENSMUSG00000026492 (34%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.