CacheBy
Atlas Antibodies Anti-TFE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TFE3 Antibody

상품 한눈에 보기

Human TFE3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, Human, Mouse, Rat에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023881-100 Anti-TFE3 Antibody, transcription factor binding to IGHM enhancer 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023881-25 Anti-TFE3 Antibody, transcription factor binding to IGHM enhancer 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFE3 Antibody

Anti-TFE3 Antibody

Target: transcription factor binding to IGHM enhancer 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human TFE3


Alternative Gene Names

  • bHLHe33
  • TFEA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transcription factor binding to IGHM enhancer 3
Target Gene TFE3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000000134 92%
Rat ENSRNOG00000009605 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 최적의 농도 및 조건은 사용자가 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.