Atlas Antibodies Anti-TFE3 Antibody

상품 한눈에 보기

Human TFE3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, Human, Mouse, Rat에 반응합니다.

카탈로그번호: HPA023881-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023881-100 Anti-TFE3 Antibody, transcription factor binding to IGHM enhancer 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023881-25 Anti-TFE3 Antibody, transcription factor binding to IGHM enhancer 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TFE3 Antibody

Anti-TFE3 Antibody

Target: transcription factor binding to IGHM enhancer 3
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) — Genetic validation by siRNA knockdown
Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human TFE3

Alternative Gene Names

bHLHe33
TFEA

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	transcription factor binding to IGHM enhancer 3
Target Gene	TFE3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000000134	92%
Rat	ENSRNOG00000009605	92%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand