CacheBy
Atlas Antibodies Anti-TFEC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TFEC Antibody

상품 한눈에 보기

인간 TFEC 단백질을 타겟으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태로 높은 특이성과 재현성을 제공. 면역세포화학(ICC) 등 다양한 응용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA063577-100 Anti-TFEC Antibody, transcription factor EC 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063577-25 Anti-TFEC Antibody, transcription factor EC 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFEC Antibody

Anti-TFEC Antibody

Target: Transcription Factor EC (TFEC)
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TFEC.

Alternative Gene Names

  • bHLHe34
  • TCFEC
  • TFECL

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Transcription factor EC
Target Gene TFEC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000061595 (90%)
Mouse ENSMUSG00000029553 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.