
Thermo Fisher Scientific PTPRF Polyclonal Antibody
상품 한눈에 보기
PTPRF 단백질에 특이적인 Rabbit Polyclonal 항체로 Western Blot 및 IHC(Paraffin) 실험에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 세포 부착 및 신호 조절 관련 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167–1203 aa, EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747013 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PTPRF는 세포 부착 수용체로 작용할 가능성이 있으며, 고유한 단백질 티로신 인산화효소(PTPase) 활성을 가집니다. 이 단백질은 단백질 티로신 인산화효소(PTP) 계열에 속하며, 신호 전달 조절에 관여하는 것으로 알려져 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific PYY Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Paxillin Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PTPRF Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PSMA3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PTPN22 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.