원본

Thermo Fisher Scientific PTPRF Polyclonal Antibody

상품 한눈에 보기

PTPRF 단백질에 특이적인 Rabbit Polyclonal 항체로 Western Blot 및 IHC(Paraffin) 실험에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 세포 부착 및 신호 조절 관련 연구용으로 적합.

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2025. 07. 31. 오전 05:23

카탈로그 번호 · 상품 설명출고판매가담기

Thermo Fisher Scientific PA579898 PTPRF Polyclonal Antibody 100 ug pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

568,000원VAT 포함 624,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Application	Tested Dilution
Western Blot (WB)	0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))	0.5–1 µg/mL

항목	내용
Species Reactivity	Human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167–1203 aa, EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK)
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage buffer	PBS with 5 mg BSA
Contains	0.05 mg sodium azide
Storage conditions	–20°C
Shipping conditions	Ambient (domestic); Wet ice (international)
RRID	AB_2747013

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

PTPRF는 세포 부착 수용체로 작용할 가능성이 있으며, 고유한 단백질 티로신 인산화효소(PTPase) 활성을 가집니다. 이 단백질은 단백질 티로신 인산화효소(PTP) 계열에 속하며, 신호 전달 조절에 관여하는 것으로 알려져 있습니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.