CacheBy
Thermo Fisher Scientific TAP2 Polyclonal Antibody
원본

Thermo Fisher Scientific TAP2 Polyclonal Antibody

상품 한눈에 보기

Human TAP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 10:13
Thermo Fisher Scientific PA580096 TAP2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific TAP2 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL
  • Publications: -

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611–651aa, QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2747211

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

The membrane-associated protein encoded by this gene is a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes and are divided into seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

This protein belongs to the MDR/TAP subfamily, which is involved in multidrug resistance. The TAP2 gene is located 7 kb telomeric to ABCB2 and is involved in antigen presentation. TAP2 forms a heterodimer with ABCB2 to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing produces two isoforms differing in peptide selectivity and MHC class I surface expression.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.