
Thermo Fisher Scientific TAP2 Polyclonal Antibody
Human TAP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: -
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611–651aa, QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747211 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The membrane-associated protein encoded by this gene is a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes and are divided into seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This protein belongs to the MDR/TAP subfamily, which is involved in multidrug resistance. The TAP2 gene is located 7 kb telomeric to ABCB2 and is involved in antigen presentation. TAP2 forms a heterodimer with ABCB2 to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing produces two isoforms differing in peptide selectivity and MHC class I surface expression.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific TAT Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TAB1 Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific TAP2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TAB1 Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific Synaptotagmin 1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|