
Thermo Fisher Scientific TAP2 Polyclonal Antibody
Human TAP2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TAP2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: -
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611–651aa, QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747211 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The membrane-associated protein encoded by this gene is a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes and are divided into seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This protein belongs to the MDR/TAP subfamily, which is involved in multidrug resistance. The TAP2 gene is located 7 kb telomeric to ABCB2 and is involved in antigen presentation. TAP2 forms a heterodimer with ABCB2 to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing produces two isoforms differing in peptide selectivity and MHC class I surface expression.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
