
Thermo Fisher Scientific TAT Polyclonal Antibody
Thermo Fisher Scientific의 TAT Polyclonal Antibody는 인간, 마우스, 랫트에 반응하는 Rabbit IgG 항체입니다. Western blot에 적합하며, 합성 펩타이드 기반 면역원으로 제작되었습니다. 항원 친화 크로마토그래피로 정제되었으며, 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB)
Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169–208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747212 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TAT is a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
- PA5-80097_TAT_P17735-1_Rabbit.svg
- PA5-80097_TAT_P17735-1_Rabbit_PDP.jpeg
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific TAP1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TBP Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TAT Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TAB1 Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific TAP2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|