원본
Thermo Fisher Scientific TAT Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 TAT Polyclonal Antibody는 인간, 마우스, 랫트에 반응하는 Rabbit IgG 항체입니다. Western blot에 적합하며, 합성 펩타이드 기반 면역원으로 제작되었습니다. 항원 친화 크로마토그래피로 정제되었으며, 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 03:37
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580097 TAT Polyclonal Antibody 100 ug pk판매 단위 pk
재고 1개
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific TAT Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169–208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747212 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TAT is a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
- PA5-80097_TAT_P17735-1_Rabbit.svg
- PA5-80097_TAT_P17735-1_Rabbit_PDP.jpeg
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific TAP1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TBP Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TAB1 Polyclonal Antibody514,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TAP2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.