원본
Thermo Fisher Scientific Periplakin Polyclonal Antibody
상품 한눈에 보기
Periplakin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF, Flow Cytometry에 사용 가능. 고순도 항원 친화 크로마토그래피로 정제되었으며, 인간·마우스·랫트 반응성. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 06:01
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579856 Periplakin Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Periplakin Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.25 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664–1701 aa: DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746971 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Periplakin protein is a component of desmosomes and the epidermal cornified envelope in keratinocytes.
- N-terminal domain interacts with the plasma membrane
- C-terminal domain interacts with intermediate filaments
- Forms complexes with envoplakin through its rod domain
- May link the cornified envelope, desmosomes, and intermediate filaments
- Reported interaction with AKT1/PKB suggests a role in AKT1-mediated signaling localization
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MYPT1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CPI-17 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PPBP Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PPBP Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.