Thermo Fisher Scientific Periplakin Polyclonal Antibody
상품 한눈에 보기
Periplakin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF, Flow Cytometry에 사용 가능. 고순도 항원 친화 크로마토그래피로 정제되었으며, 인간·마우스·랫트 반응성. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.25 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664–1701 aa: DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746971 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Periplakin protein is a component of desmosomes and the epidermal cornified envelope in keratinocytes.
- N-terminal domain interacts with the plasma membrane
- C-terminal domain interacts with intermediate filaments
- Forms complexes with envoplakin through its rod domain
- May link the cornified envelope, desmosomes, and intermediate filaments
- Reported interaction with AKT1/PKB suggests a role in AKT1-mediated signaling localization
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MYPT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CPI-17 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Periplakin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PPBP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PPBP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.