
원본
Thermo Fisher Scientific Periplakin Polyclonal Antibody
상품 한눈에 보기
Periplakin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF, Flow Cytometry에 사용 가능. 고순도 항원 친화 크로마토그래피로 정제되었으며, 인간·마우스·랫트 반응성. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 06:01
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579856 Periplakin Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Periplakin Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.25 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664–1701 aa: DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746971 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Periplakin protein is a component of desmosomes and the epidermal cornified envelope in keratinocytes.
- N-terminal domain interacts with the plasma membrane
- C-terminal domain interacts with intermediate filaments
- Forms complexes with envoplakin through its rod domain
- May link the cornified envelope, desmosomes, and intermediate filaments
- Reported interaction with AKT1/PKB suggests a role in AKT1-mediated signaling localization
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
