Thermo Fisher Scientific MYPT1 Polyclonal Antibody
MYPT1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot, IHC, ICC/IF, Flow cytometry에 적합합니다. 고순도 항원 친화 크로마토그래피 정제 및 안정적 PBS/BSA 버퍼로 제공되며 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1–40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746972 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Myosin phosphatase target subunit 1 (MYPT1), also known as the myosin-binding subunit of myosin phosphatase, is one of the key subunits of myosin phosphatase.
Myosin phosphatase regulates the interaction between actin and myosin downstream of the small GTPase Rho.
Activated RhoA interacts with MYPT1 to modulate myosin light chain (MLC) phosphorylation, affecting smooth muscle contraction and actin–myosin interaction in nonmuscle cells.
Rho-kinase, activated by GTP-bound RhoA, phosphorylates and inactivates MYPT1, thereby inhibiting myosin phosphatase activity.
Overexpression of RhoA or activated RhoA increases phosphorylation of MYPT1 and MLC.
Several transcript variants encoding different isoforms have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PRDX2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PRDX5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MYPT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CPI-17 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Periplakin Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|