Thermo Fisher Scientific MYPT1 Polyclonal Antibody
MYPT1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot, IHC, ICC/IF, Flow cytometry에 적합합니다. 고순도 항원 친화 크로마토그래피 정제 및 안정적 PBS/BSA 버퍼로 제공되며 연구용으로만 사용됩니다.
- 카탈로그번호
- PA579857
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MYPT1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1–40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746972 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Myosin phosphatase target subunit 1 (MYPT1), also known as the myosin-binding subunit of myosin phosphatase, is one of the key subunits of myosin phosphatase.
Myosin phosphatase regulates the interaction between actin and myosin downstream of the small GTPase Rho.
Activated RhoA interacts with MYPT1 to modulate myosin light chain (MLC) phosphorylation, affecting smooth muscle contraction and actin–myosin interaction in nonmuscle cells.
Rho-kinase, activated by GTP-bound RhoA, phosphorylates and inactivates MYPT1, thereby inhibiting myosin phosphatase activity.
Overexpression of RhoA or activated RhoA increases phosphorylation of MYPT1 and MLC.
Several transcript variants encoding different isoforms have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.