
원본
Thermo Fisher Scientific ACTH Polyclonal Antibody
상품 한눈에 보기
ACTH에 특이적인 Rabbit Polyclonal Antibody로 다양한 종에 반응. Western blot, IHC, ICC, ELISA 등 다중 응용 가능. 액상 형태로 친화 크로마토그래피 정제. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Thermo Fisher Scientific ACTH-101AP ACTH Polyclonal Antibody 200 ul pk판매 단위 pk
재고 확인 필요
449,700원VAT 포함 494,670원
Thermo Fisher Scientific · Thermo Fisher Scientific ACTH Polyclonal Antibody
Thermo Fisher Scientific ACTH Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:100–1:250 |
| Dot blot (DB) | 1:10,000 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to ACTH aa 138–176 (Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
ATCH (adrenocorticotropic hormone, ACTH)는 부신피질을 자극하는 주요 호르몬으로, 전구체인 proopiomelanocortin (POMC)의 절단을 통해 생성됩니다. 이 과정에서 MSH, ACTH, β-endorphin 등의 다른 절단 산물이 함께 생성됩니다. ACTH는 시상하부에서 분비되는 corticotropin-releasing hormone에 반응하여 전엽에서 분비되며, 코르티솔과 같은 글루코코르티코이드의 분비를 촉진합니다. 그러나 알도스테론과 같은 미네랄코르티코이드의 분비에는 거의 영향을 미치지 않습니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
