Thermo Fisher Scientific ACTH Polyclonal Antibody
ACTH에 특이적인 Rabbit Polyclonal Antibody로 다양한 종에 반응. Western blot, IHC, ICC, ELISA 등 다중 응용 가능. 액상 형태로 친화 크로마토그래피 정제. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific ACTH Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:100–1:250 |
| Dot blot (DB) | 1:10,000 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to ACTH aa 138–176 (Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
ATCH (adrenocorticotropic hormone, ACTH)는 부신피질을 자극하는 주요 호르몬으로, 전구체인 proopiomelanocortin (POMC)의 절단을 통해 생성됩니다. 이 과정에서 MSH, ACTH, β-endorphin 등의 다른 절단 산물이 함께 생성됩니다. ACTH는 시상하부에서 분비되는 corticotropin-releasing hormone에 반응하여 전엽에서 분비되며, 코르티솔과 같은 글루코코르티코이드의 분비를 촉진합니다. 그러나 알도스테론과 같은 미네랄코르티코이드의 분비에는 거의 영향을 미치지 않습니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ACTH Polyclonal Antibody, FITC
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC22A2 (OCT2) Polyclonal Antibody
742,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACTH Polyclonal Antibody
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific ACTH Polyclonal Antibody, Biotin
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific OCTN1/SLC22A4 Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|