
원본
Thermo Fisher Scientific ACTH Polyclonal Antibody, Biotin
상품 한눈에 보기
ACTH를 표적으로 하는 Thermo Fisher Scientific의 Biotin 결합 폴리클로날 항체로, WB, IHC, ICC, ELISA 등 다양한 응용에 적합. Rabbit IgG 기반으로 높은 특이성과 감도를 제공하며, 액상 형태로 안정적인 보관 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Thermo Fisher Scientific ACTH-BIOTIN ACTH Polyclonal Antibody, Biotin 200 ul pk판매 단위 pk
재고 확인 필요
594,400원VAT 포함 653,840원
Thermo Fisher Scientific · Thermo Fisher Scientific ACTH Polyclonal Antibody, Biotin
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:100–1:250 |
| Dot blot (DB) | 1:10,000 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to ACTH aa 138–176 (Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) |
| Conjugate | Biotin |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
ATCH (adrenocorticotropic hormone, ACTH)는 부신피질을 자극하는 주요 호르몬으로, 전구체인 proopiomelanocortin (POMC)의 절단을 통해 생성됩니다. 이 과정에서 MSH, ACTH, β-endorphin 등의 여러 펩타이드가 생성됩니다. ATCH는 시상하부에서 분비되는 corticotropin-releasing hormone에 의해 전엽에서 분비되며, cortisol과 같은 글루코코르티코이드의 분비를 자극합니다. 그러나 알도스테론과 같은 미네랄코르티코이드에는 거의 영향을 미치지 않습니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
