CacheBy
Thermo Fisher Scientific ACTH Polyclonal Antibody, FITC
원본

Thermo Fisher Scientific ACTH Polyclonal Antibody, FITC

상품 한눈에 보기

ACTH 단백질을 인식하는 FITC 결합 폴리클로날 항체로, Western blot, IHC, ICC, ELISA 등 다양한 면역분석에 적합합니다. 사람, 생쥐, 설치류 등 여러 종에 반응하며, 고순도 친화 크로마토그래피 정제 제품입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Thermo Fisher Scientific ACTH-FITC ACTH Polyclonal Antibody, FITC 200 ul pk판매 단위 pk
재고 확인 필요
594,400원VAT 포함 653,840원

Thermo Fisher Scientific · Thermo Fisher Scientific ACTH Polyclonal Antibody, FITC

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 1:500–1:1,000
Immunohistochemistry (IHC) 1:50–1:250
Immunocytochemistry (ICC/IF) 1:50–1:250
ELISA 1:10,000
Immunoprecipitation (IP) 1:100–1:250
Dot blot (DB) 1:10,000
Immunomicroscopy (IM) 1:50–1:200

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Non-human primate, Rat
Host/Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to ACTH aa 138–176 (Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF)
Conjugate FITC (Fluorescein isothiocyanate)
Excitation/Emission Max 498 / 517 nm
Form Liquid
Concentration 0.5–1.5 mg/mL
Purification Affinity chromatography
Storage Buffer Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA
Contains 0.02% sodium azide
Storage Conditions −20 °C, store in dark
Shipping Conditions Ambient (domestic); Wet ice (international)

Target Information

ATCH (adrenocorticotropic hormone)는 부신 피질을 자극하는 주요 호르몬으로, 전엽에서 분비됩니다. 전구체 단백질인 proopiomelanocortin (POMC)의 절단을 통해 생성되며, 이 과정에서 MSH, ACTH, 베타 엔도르핀 등의 다른 펩타이드도 함께 형성됩니다. ACTH는 시상하부에서 분비되는 corticotropin-releasing hormone에 반응하여 분비되며, 코르티솔과 같은 글루코코르티코이드의 분비를 자극합니다. 그러나 알도스테론과 같은 미네랄코르티코이드의 분비에는 거의 영향을 주지 않습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

spectra

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.