Thermo Fisher Scientific ACTH Polyclonal Antibody, FITC
ACTH 단백질을 인식하는 FITC 결합 폴리클로날 항체로, Western blot, IHC, ICC, ELISA 등 다양한 면역분석에 적합합니다. 사람, 생쥐, 설치류 등 여러 종에 반응하며, 고순도 친화 크로마토그래피 정제 제품입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:100–1:250 |
| Dot blot (DB) | 1:10,000 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to ACTH aa 138–176 (Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) |
| Conjugate | FITC (Fluorescein isothiocyanate) |
| Excitation/Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | −20 °C, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
ATCH (adrenocorticotropic hormone)는 부신 피질을 자극하는 주요 호르몬으로, 전엽에서 분비됩니다. 전구체 단백질인 proopiomelanocortin (POMC)의 절단을 통해 생성되며, 이 과정에서 MSH, ACTH, 베타 엔도르핀 등의 다른 펩타이드도 함께 형성됩니다. ACTH는 시상하부에서 분비되는 corticotropin-releasing hormone에 반응하여 분비되며, 코르티솔과 같은 글루코코르티코이드의 분비를 자극합니다. 그러나 알도스테론과 같은 미네랄코르티코이드의 분비에는 거의 영향을 주지 않습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific beta Actin Polyclonal Antibody, FITC
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific beta Actin Polyclonal Antibody
171,100원
Thermo Fisher Scientific
Thermo Fisher Scientific ACTH Polyclonal Antibody, FITC
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC22A2 (OCT2) Polyclonal Antibody
742,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACTH Polyclonal Antibody
449,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|