
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPTC7 Antibody
상품 한눈에 보기
인간 PPTC7 단백질에 특이적인 폴리클로날 항체로, WB·IHC·ICC 등 다양한 응용에 적합. 토끼 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 인간·마우스·랫트 반응성 검증 완료. PBS와 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA040614-100 Anti-PPTC7 Antibody, PTC7 protein phosphatase homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040614-25 Anti-PPTC7 Antibody, PTC7 protein phosphatase homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPTC7 Antibody
Anti-PPTC7 Antibody
PTC7 protein phosphatase homolog (S. cerevisiae)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent validation available)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PPTC7
Alternative Gene Names
- TA-PP2C
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PTC7 protein phosphatase homolog (S. cerevisiae) |
| Target Gene | PPTC7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000038582 (99%) Rat ENSRNOG00000021440 (99%) |
Antigen Sequence:
ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



