Atlas Antibodies Anti-PPTC7 Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA040614-100 | - | Atlas Antibodies HPA040614-100 Anti-PPTC7 Antibody, PTC7 protein phosphatase homolog (S. cerevisiae) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA040614-25 | - | Atlas Antibodies HPA040614-25 Anti-PPTC7 Antibody, PTC7 protein phosphatase homolog (S. cerevisiae) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-PPTC7 Antibody
PTC7 protein phosphatase homolog (S. cerevisiae)
Recommended Applications
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PPTC7
Alternative Gene Names
TA-PP2C
Target Protein
PTC7 protein phosphatase homolog (S. cerevisiae)
Target Gene
PPTC7
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000038582 (99%)
Rat ENSRNOG00000021440 (99%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|