CacheBy
Atlas Antibodies Anti-PPTC7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPTC7 Antibody

상품 한눈에 보기

인간 PPTC7 단백질에 특이적인 폴리클로날 항체로, WB·IHC·ICC 등 다양한 응용에 적합. 토끼 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 인간·마우스·랫트 반응성 검증 완료. PBS와 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040614-100 Anti-PPTC7 Antibody, PTC7 protein phosphatase homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040614-25 Anti-PPTC7 Antibody, PTC7 protein phosphatase homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPTC7 Antibody

Anti-PPTC7 Antibody

PTC7 protein phosphatase homolog (S. cerevisiae)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation available)
  • ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PPTC7


Alternative Gene Names

  • TA-PP2C

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein PTC7 protein phosphatase homolog (S. cerevisiae)
Target Gene PPTC7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000038582 (99%)
Rat ENSRNOG00000021440 (99%)

Antigen Sequence:
ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.