
Atlas Antibodies Anti-PPP6R3 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-PPP6R3 항체는 인간 PPP6R3 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, 고순도 Affinity purification 방식으로 제조되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP6R3 Antibody
Target Protein: protein phosphatase 6, regulatory subunit 3
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human PPP6R3
Alternative Gene Names
C11orf23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558, MGC125711, MGC125712, PP6R3, SAP190, SAPL, SAPLa, SAPS3
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 6, regulatory subunit 3 |
| Target Gene | PPP6R3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (96%), Mouse (95%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal conditions should be determined by the user. |
Antigen Sequence
DGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEP제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPTC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPTC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP6R3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPRC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP6R2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.