AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPRC1 Antibody
상품 한눈에 보기
Human PPRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 응용에 적합. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형식. 인간에 대한 검증된 반응성과 안정적 보존 용액 제공.
- 카탈로그번호
- HPA057571-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057571-100 Anti-PPRC1 Antibody, peroxisome proliferator-activated receptor gamma, coactivator-related 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057571-25 Anti-PPRC1 Antibody, peroxisome proliferator-activated receptor gamma, coactivator-related 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPRC1 Antibody
Anti-PPRC1 Antibody
Target: peroxisome proliferator-activated receptor gamma, coactivator-related 1 (PPRC1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PPRC1.
Alternative Gene Names
KIAA0595, MGC74642, PRC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | peroxisome proliferator-activated receptor gamma, coactivator-related 1 |
| Target Gene | PPRC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQ |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000018561 | 76% |
| Mouse | ENSMUSG00000055491 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.