
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPT1 Antibody
상품 한눈에 보기
Human PPT1 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. siRNA knockdown으로 유전적 검증 완료. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. PBS 기반 버퍼에 glycerol과 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA021546-100 Anti-PPT1 Antibody, palmitoyl-protein thioesterase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021546-25 Anti-PPT1 Antibody, palmitoyl-protein thioesterase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPT1 Antibody
Anti-PPT1 Antibody
Target Protein: palmitoyl-protein thioesterase 1 (PPT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal antibody against human PPT1
Alternative Gene Names
CLN1, INCL, PPT
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000012616 | 87% |
| Mouse | ENSMUSG00000028657 | 85% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



