CacheBy
Atlas Antibodies Anti-PPT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPT1 Antibody

상품 한눈에 보기

Human PPT1 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. siRNA knockdown으로 유전적 검증 완료. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. PBS 기반 버퍼에 glycerol과 sodium azide 포함.

카탈로그번호
HPA021546-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021546-100 Anti-PPT1 Antibody, palmitoyl-protein thioesterase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021546-25 Anti-PPT1 Antibody, palmitoyl-protein thioesterase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPT1 Antibody

Anti-PPT1 Antibody

Target Protein: palmitoyl-protein thioesterase 1 (PPT1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Genetic validation in WB by siRNA knockdown

Product Description

Polyclonal antibody against human PPT1

Alternative Gene Names

CLN1, INCL, PPT

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000012616 87%
Mouse ENSMUSG00000028657 85%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.