
Atlas Antibodies Anti-PPTC7 Antibody
상품 한눈에 보기
Human PPTC7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람, 마우스, 랫트에 반응합니다. 단백질 발현 검증에 유용합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPTC7 Antibody
PTC7 protein phosphatase homolog (S. cerevisiae)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Validation of protein expression in WB
Independent antibodies targeting different epitopes of the protein were compared to validate expression.
Product Description
Polyclonal Antibody against Human PPTC7
Alternative Gene Names
TA-PP2C
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PTC7 protein phosphatase homolog (S. cerevisiae) |
| Target Gene | PPTC7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일도 |
|---|---|---|
| Rat | ENSRNOG00000021440 | 99% |
| Mouse | ENSMUSG00000038582 | 99% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPRC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPTC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPTC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP6R3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPRC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.