Thermo Fisher Scientific DARPP-32 Polyclonal Antibody
DARPP-32 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot, IHC, Flow cytometry 등 다양한 응용에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg / 1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP-32 (1–36 aa: MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746974 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
DARPP-32 is a dopamine (DA) and AMP-regulated ~32 kDa phosphoprotein associated with dopaminoceptive neurons. When phosphorylated at Thr34, it inhibits Protein Phosphatase I; when phosphorylated at Thr75, it inhibits PKA. Phosphorylation of DARPP-32 plays a critical role in dopaminergic neurotransmission regulation and is implicated in the actions of alcohol, caffeine, and Prozac®.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PPT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PRDX5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DARPP-32 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Blimp-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PRDX2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|