
Thermo Fisher Scientific PPT1 Polyclonal Antibody
PPT1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체로, 인간·마우스·랫트 반응성. 연구용 전용 제품.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PPT1 Polyclonal Antibody
Thermo Fisher Scientific PPT1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human PPT1 (C-terminus, 191–224aa: KEDVYRNHSIFLADINQERGINESYKKNLMALKK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746975 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The PPT1 protein is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. It removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Mutations in this gene are associated with infantile neuronal ceroid lipofuscinosis 1 (CLN1, INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been identified.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지

Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
